$(document).ready(function() { 'use strict'; checkCollapseState(); keepFooterFixedToBottom(); addSeqValidation(); inputValidation(); $(document).bind('keydown', function (e) { if (e.ctrlKey && e.keyCode === 13 ) { $('#input').trigger('submit'); } }); }); // Looks for a cookie (called 'NeuroHmmer_adv_params_status') to check the state of the adv_params box when it was last closed. // This function is called upon as soon as the website is loaded; var checkCollapseState = function () { 'use strict'; if ($.cookie('NeuroHmmer_adv_params_status')){ var adv_params_status = $.cookie('NeuroHmmer_adv_params_status'); if (adv_params_status === 'open') { var btn = document.getElementById('adv_params_btn'); btn.innerHTML = '  Hide Advanced Parameters'; $('#adv_params').addClass('in'); } } }; // This function simply ensures that the footer stays to fixed to the bottom of the window var keepFooterFixedToBottom = function () { 'use strict'; $('#mainbody').css({'margin-bottom': (($('#footer').height()) + 15)+'px'}); $(window).resize(function(){ $('#mainbody').css({'margin-bottom': (($('#footer').height()) + 15)+'px'}); }); }; // Creates a custom Validation for Jquery Validation plugin... // It ensures that sequences are either protein or DNA data... // If there are multiple sequences, ensures that they are of the same type // It utilises the checkType function (further below)... var addSeqValidation = function () { 'use strict'; jQuery.validator.addMethod('checkInputType', function(value, element) { var types = [], type = ''; if (value.charAt(0) === '>') { var seqs_array = value.split('>'); for (var i = 1; i < seqs_array.length; i++) { var lines = seqs_array[i].split('\n'); if (lines.length !== 0) { var clean_lines = jQuery.grep(lines,function(n){ return(n); }); if (clean_lines.length !== 0){ clean_lines.shift(); var seq = clean_lines.join(''); type = checkType(seq, 0.9); types.push(type); if ((type !== 'protein') && (type !== 'dna') && (type !== 'rna')) { return false; } } } } var firstType = types[0]; for (var j = 0; j < types.length; j++) { if (types[j] !== firstType){ return false; } } return true; } else { type = checkType(value, 0.9); if ((type !== 'protein') && (type !== 'dna') && (type !== 'rna')) { return false; } else { return true; } } }, '* The Input must be either DNA or protein sequence(s). Please ensure that your sequences do not contains any non-letter character(s). If there are multiple sequences, ensure that they are all of one type. '); }; // A function that validates the input - Utilises Jquery.Validator.js var inputValidation = function () { 'use strict'; var maxCharacters = $('#seq').attr('data-maxCharacters'); // returns a number or undefined $('#input').validate({ rules: { seq: { minlength: 5, required: true, checkInputType: true, maxlength: maxCharacters // when undefined, maxlength is unlimited }, 'neuropeptides[]': { required: true, }, }, highlight: function(element) { $(element).closest('.form-group').addClass('has-error'); }, unhighlight: function(element) { $(element).closest('.form-group').removeClass('has-error'); }, errorElement: 'span', errorClass: 'help-block', errorPlacement: function(error, element) { if (element.parent().parent().attr('id') === 'validations_group') { var helpText = document.getElementById('lastValidation'); error.insertAfter(helpText); } else { if (element.parent('.input-group').length) { error.insertAfter(element.parent()); } else { error.insertAfter(element); } } }, submitHandler: function(form) { $('#spinner').modal({ backdrop: 'static', keyboard: 'false' }); ajaxFunction(); } }); }; // Sends the data within the form to the Server var ajaxFunction = function () { 'use strict'; $.ajax({ type: 'POST', url: $('#input').attr('action'), data: $('#input').serialize(), success: function(response){ $('#results_box').show(); $('#output').html(response); $('#mainbody').css({'background-color': '#fff'}); $('#search').css({'background-color': '#F5F5F5'}); $('#results').css({'border-top': '3px solid #DBDBDB'}); $('#search').css({'margin-bottom': '0'}); $('#spinner').modal('hide'); // remove progress notification }, error: function (e, status) { var errorMessage; if (e.status == 500 || e.status == 400) { errorMessage = e.responseText; $('#results_box').show(); $('#output').html(errorMessage); $('#spinner').modal('hide'); // remove progress notification } else { errorMessage = e.responseText; $('#results_box').show(); $('#output').html('There seems to be an unidentified Error.'); $('#spinner').modal('hide'); // remove progress notification } } }); }; // Function is called each time the Adv. Params button is pressed... var changeAdvParamsBtnText = function () { 'use strict'; var btn = document.getElementById('adv_params_btn'); if (btn.innerHTML === '  Show Advanced Parameters') { btn.innerHTML = '  Hide Advanced Parameters'; $('#adv_params').collapse('show'); $.cookie('NeuroHmmer_adv_params_status', 'open'); } else { btn.innerHTML = '  Show Advanced Parameters'; $('#adv_params').collapse('hide'); $.cookie('NeuroHmmer_adv_params_status', 'closed'); } }; // Changes the input to an examplar dna or protein sequence... var examplarSequences = function (){ 'use strict'; var seqs = '>gi|752421898|ref|XP_011230170.1| PREDICTED: glucagon [Ailuropoda melanoleuca]\n' + 'MKSIYFVAGLFVMLVQGSWQRSLQDTEEKSRSLPAPQTDPLNDPDQMNEDKRHSQGTFTSDYSKYLDSRRAQDFVQWLMSTKRNKNNIAKRHDEFERHAEGTFTSDVSSYLEGQAAKEFIAWLVKGRGRRDFPEEVAIVEELRRRHADGSFSDEMNTVLDDLATRDFINWLLQTKITER\n' + '>gi|328711854|ref|XP_003244660.1| PREDICTED: uncharacterized protein LOC100571180 [Acyrthosiphon pisum]\n' + 'MVKIGLPWLLLVLMKLTNREIKSDEIISIQEVYDICQAEPNTDICDLLEKSSSLVDLNKLDSPEKRRQKTVFSSWGGKRQSTYPYGGKRPAFSSWGGKRASDKHGRPKQTFSSWGGKRSDYDGYDNGEMDEHQMDKRELNGIKQDKNNYRNKMTKGIHALFTIFSDWSRDPEEKKGIRYAGIKSMRRSSDFFPWGGKRFTGDAK\n' + '>gi|301771746|ref|XP_002921293.1| PREDICTED: thyrotropin releasing hormone [Ailuropoda melanoleuca]\n' + 'MPGPWLQLAMALTLTVAGIPGGRAQPEVAQQEAAMAPERAGLDDLLRQAQRLLFLREDLQRLRGNQGDLESEAQILQPDWLSKRQHPGKREGEAEEGVEEEEEEGGAVGPHKRQHPGRQEDVAAWSDVTLQKRQHPGRRAPLLGYAFTKRQHPGRRLVDSKAQRSWEAEEEDGEEEGGEPMPEKRQHPGKRALGSPCGPGAACGQASLLLGLLDDLSRGQGAEEKRQHPGRRAAWAREPLEE\n' + '>gi|328710353|ref|XP_003244236.1| PREDICTED: uncharacterized protein LOC100573178 [Acyrthosiphon pisum]\n' + 'MTMSVTITILCILGSTFLLIMPDNTTASDKFFQTGGRFGKRHDEHIPDIRYAAMVKTRSVDNVPPRIERGFYISRYGKRSTNSITDPYYFTLCLPSYGIYCDFTGLPNLLRCKRIQPGACSNLNYVNEKTQMKPDNDIII\n' + '>gi|641659926|ref|XP_008181304.1| PREDICTED: uncharacterized protein LOC100570556 isoform X2 [Acyrthosiphon pisum]\n' + 'MHKFFVQIYIFVLIIWAVEKSDCKQGACLNYGHSCWGAHGKRNVPNDLDSLIRYRMAVFKKSGHRDSFINPNADQSQEDIPNYYNIFKHYSKINSVKTNNDDTVDTWSLEPSNNLPSGGSYYEDQVLDPRIEYKIMKI\n' + '>gi|328717573|ref|XP_003246245.1| PREDICTED: uncharacterized protein LOC100568735 [Acyrthosiphon pisum]\n' + 'MPHKINVGLVALAALAAAVLADPSVDRRASMGFMGMRGKKDRDQGGGGSGGDETSAAVDLDKRTMVFRRPMFDGGSRPAVFGGGSAEGFKRASMGFMGMRGKKDYYSNNKGSAAGFFGMRGKKVPSADAFYGVRGKKWPDHEDAVDADVQLSPIYILYRIIDELKSELSDRERNLVAAKFDEEREMR\n' document.getElementById('seq').value = seqs; }; // FROM BIONODE-Seq - See https://github.com/bionode/bionode-seq // Checks whether a sequence is a protein or dna sequence... var checkType = function (sequence, threshold, length, index) { 'use strict'; if (threshold === undefined) { threshold = 0.9; } if (length === undefined) { length = 10000; } if (index === undefined) { index = 1; } var seq = sequence.slice(index - 1, length); var dnaSeq = seq.replace(/N/gi,''); var dnaTotal = dnaSeq.length; var acgMatch = ((dnaSeq.match(/[ACG]/gi) || []).length) / dnaTotal; var tMatch = ((dnaSeq.match(/[T]/gi) || []).length) / dnaTotal; var uMatch = ((dnaSeq.match(/[U]/gi) || []).length) / dnaTotal; var proteinSeq = seq.replace(/X/gi,''); var proteinTotal = proteinSeq.length; var proteinMatch = ((seq.match(/[ARNDCQEGHILKMFPSTWYV\*]/gi) || []).length) / proteinTotal; if (((acgMatch + tMatch) >= threshold) || ((acgMatch + uMatch) >= threshold)) { if (tMatch >= uMatch) { return 'dna'; } else if (uMatch >= tMatch) { return 'rna'; } else { return 'dna'; } } else if (proteinMatch >= threshold) { return 'protein'; } };