Blast4-archive ::= {
  request {
    ident "2.2.30+",
    body queue-search {
      program "tblastn",
      service "plain",
      queries bioseq-set {
        seq-set {
          seq {
            id {
              local str "Query_1"
            },
            descr {
              user {
                type str "CFastaReader",
                data {
                  {
                    label str "DefLine",
                    data str ">SI2.2.0_06267
 locus=Si_gnF.scaffold02592[1282609..1284114].pep_2 quality=100.00"
                  }
                }
              },
              title "SI2.2.0_06267
 locus=Si_gnF.scaffold02592[1282609..1284114].pep_2 quality=100.00"
            },
            inst {
              repr raw,
              mol aa,
              length 199,
              seq-data ncbieaa "MNTLWLSLWDYPGKLPLNFMVFDTKDDLQAAYWRDPYSIPLAVIFE
DPQPISQRLIYEIRTNPSYTLPPPPTKLYSAPISCRKNKTGHWMDDILSIKTGESCPVNNYLHSGFLALQMITDITKI
KLENSDVTIPDIKLIMFPKEPYTADWMLAFRVVIPLYMVLALSQFITYLLILIVGEKENKIKEGMKMMGLNDSVF"
            }
          },
          seq {
            id {
              local str "Query_2"
            },
            descr {
              user {
                type str "CFastaReader",
                data {
                  {
                    label str "DefLine",
                    data str ">SI2.2.0_13722
 locus=Si_gnF.scaffold06207[1925625..1928536].pep_1 quality=100.00"
                  }
                }
              },
              title "SI2.2.0_13722
 locus=Si_gnF.scaffold06207[1925625..1928536].pep_1 quality=100.00"
            },
            inst {
              repr raw,
              mol aa,
              length 186,
              seq-data ncbieaa "MSANRLNVLVTLMLAVALLVTESGNAQVDGYLQFNPKRSAVSSPQK
YCGKKLSNALQIICDGVYNSMFKKSGQDFPPQNKRHIAHRINGNEEESFTTLKSNFLNWCVEVYHRHYRFVFVSEMEM
ADYPLAYDISPYLPPFLSRARARGMLDGRFAGRRYRRESRGIHEECCINGCTINELTSYCGP"
            }
          }
        }
      },
      subject database "../database/sample/transcripts/Solenopsis_invicta/Si
nvicta2-2-3.cdna.subset.fasta",
      algorithm-options {
        {
          name "EvalueThreshold",
          value cutoff e-value { 1, 10, 1 }
        },
        {
          name "DbGeneticCode",
          value integer 1
        },
        {
          name "UngappedMode",
          value boolean FALSE
        },
        {
          name "LongestIntronLength",
          value integer 0
        },
        {
          name "MaskAtHash",
          value boolean FALSE
        },
        {
          name "SegFilteringWindow",
          value integer 12
        },
        {
          name "SegFilteringLocut",
          value real { 22, 10, -1 }
        },
        {
          name "SegFilteringHicut",
          value real { 25, 10, -1 }
        },
        {
          name "WordThreshold",
          value integer 13
        },
        {
          name "WindowSize",
          value integer 40
        },
        {
          name "HitlistSize",
          value integer 500
        },
        {
          name "CompositionBasedStats",
          value integer 2
        },
        {
          name "SmithWatermanMode",
          value boolean FALSE
        },
        {
          name "EffectiveSearchSpace",
          value big-integer 9254832
        }
      }
    }
  },
  results {
    alignments {
      {
        type partial,
        dim 2,
        score {
          {
            id str "score",
            value int 1046
          },
          {
            id str "e_value",
            value real { 991472001167032, 10, -162 }
          },
          {
            id str "bit_score",
            value real { 407526988689595, 10, -12 }
          },
          {
            id str "num_ident",
            value int 199
          },
          {
            id str "comp_adjustment_method",
            value int 2
          },
          {
            id str "num_positives",
            value int 199
          },
          {
            id str "hsp_percent_coverage",
            value real { 1, 10, 2 }
          }
        },
        segs std {
          {
            dim 2,
            ids {
              local str "Query_1",
              local str "SI2.2.0_06267"
            },
            loc {
              int {
                from 0,
                to 198,
                strand unknown,
                id local str "Query_1"
              },
              int {
                from 0,
                to 596,
                strand plus,
                id local str "SI2.2.0_06267"
              }
            }
          }
        }
      },
      {
        type partial,
        dim 2,
        score {
          {
            id str "score",
            value int 46
          },
          {
            id str "e_value",
            value real { 158151944731805, 10, -14 }
          },
          {
            id str "bit_score",
            value real { 223274127722423, 10, -13 }
          },
          {
            id str "num_ident",
            value int 9
          },
          {
            id str "comp_adjustment_method",
            value int 2
          },
          {
            id str "num_positives",
            value int 15
          },
          {
            id str "hsp_percent_coverage",
            value real { 135653266331658, 10, -13 }
          }
        },
        segs std {
          {
            dim 2,
            ids {
              local str "Query_1",
              local str "SI2.2.0_06904"
            },
            loc {
              int {
                from 31,
                to 56,
                strand unknown,
                id local str "Query_1"
              },
              int {
                from 117,
                to 194,
                strand plus,
                id local str "SI2.2.0_06904"
              }
            }
          }
        }
      },
      {
        type partial,
        dim 2,
        score {
          {
            id str "score",
            value int 44
          },
          {
            id str "e_value",
            value real { 264755365382425, 10, -14 }
          },
          {
            id str "bit_score",
            value real { 215570136204075, 10, -13 }
          },
          {
            id str "num_ident",
            value int 8
          },
          {
            id str "comp_adjustment_method",
            value int 2
          },
          {
            id str "num_positives",
            value int 13
          },
          {
            id str "hsp_percent_coverage",
            value real { 803768844221105, 10, -14 }
          }
        },
        segs std {
          {
            dim 2,
            ids {
              local str "Query_1",
              local str "SI2.2.0_03432"
            },
            loc {
              int {
                from 50,
                to 64,
                strand unknown,
                id local str "Query_1"
              },
              int {
                from 37,
                to 81,
                strand plus,
                id local str "SI2.2.0_03432"
              }
            }
          }
        }
      },
      {
        type partial,
        dim 2,
        score {
          {
            id str "score",
            value int 42
          },
          {
            id str "e_value",
            value real { 738402284079177, 10, -14 }
          },
          {
            id str "bit_score",
            value real { 207866144685728, 10, -13 }
          },
          {
            id str "num_ident",
            value int 8
          },
          {
            id str "comp_adjustment_method",
            value int 2
          },
          {
            id str "num_positives",
            value int 11
          },
          {
            id str "hsp_percent_coverage",
            value real { 100477386934673, 10, -13 }
          }
        },
        segs std {
          {
            dim 2,
            ids {
              local str "Query_1",
              local str "SI2.2.0_05280"
            },
            loc {
              int {
                from 69,
                to 87,
                strand unknown,
                id local str "Query_1"
              },
              int {
                from 52,
                to 108,
                strand minus,
                id local str "SI2.2.0_05280"
              }
            }
          }
        }
      },
      {
        type partial,
        dim 2,
        score {
          {
            id str "score",
            value int 917
          },
          {
            id str "e_value",
            value real { 163109526812422, 10, -142 }
          },
          {
            id str "bit_score",
            value real { 357836243396257, 10, -12 }
          },
          {
            id str "num_ident",
            value int 170
          },
          {
            id str "comp_adjustment_method",
            value int 2
          },
          {
            id str "num_positives",
            value int 170
          },
          {
            id str "hsp_percent_coverage",
            value real { 1, 10, 2 }
          }
        },
        segs std {
          {
            dim 2,
            ids {
              local str "Query_2",
              local str "SI2.2.0_13722"
            },
            loc {
              int {
                from 0,
                to 185,
                strand unknown,
                id local str "Query_2"
              },
              int {
                from 0,
                to 557,
                strand plus,
                id local str "SI2.2.0_13722"
              }
            }
          }
        }
      },
      {
        type partial,
        dim 2,
        score {
          {
            id str "score",
            value int 70
          },
          {
            id str "e_value",
            value real { 973505195823272, 10, -18 }
          },
          {
            id str "bit_score",
            value real { 315722025942587, 10, -13 }
          },
          {
            id str "num_ident",
            value int 20
          },
          {
            id str "comp_adjustment_method",
            value int 2
          },
          {
            id str "num_positives",
            value int 27
          },
          {
            id str "hsp_percent_coverage",
            value real { 241559139784946, 10, -13 }
          }
        },
        segs std {
          {
            dim 2,
            ids {
              local str "Query_2",
              local str "SI2.2.0_13149"
            },
            loc {
              int {
                from 32,
                to 42,
                strand unknown,
                id local str "Query_2"
              },
              int {
                from 87,
                to 119,
                strand plus,
                id local str "SI2.2.0_13149"
              }
            }
          },
          {
            dim 2,
            ids {
              local str "Query_2",
              local str "SI2.2.0_13149"
            },
            loc {
              int {
                from 43,
                to 43,
                strand unknown,
                id local str "Query_2"
              },
              empty local str "SI2.2.0_13149"
            }
          },
          {
            dim 2,
            ids {
              local str "Query_2",
              local str "SI2.2.0_13149"
            },
            loc {
              int {
                from 44,
                to 59,
                strand unknown,
                id local str "Query_2"
              },
              int {
                from 120,
                to 167,
                strand plus,
                id local str "SI2.2.0_13149"
              }
            }
          },
          {
            dim 2,
            ids {
              local str "Query_2",
              local str "SI2.2.0_13149"
            },
            loc {
              empty local str "Query_2",
              int {
                from 168,
                to 170,
                strand plus,
                id local str "SI2.2.0_13149"
              }
            }
          },
          {
            dim 2,
            ids {
              local str "Query_2",
              local str "SI2.2.0_13149"
            },
            loc {
              int {
                from 60,
                to 75,
                strand unknown,
                id local str "Query_2"
              },
              int {
                from 171,
                to 218,
                strand plus,
                id local str "SI2.2.0_13149"
              }
            }
          }
        }
      },
      {
        type partial,
        dim 2,
        score {
          {
            id str "score",
            value int 64
          },
          {
            id str "e_value",
            value real { 591430689703162, 10, -17 }
          },
          {
            id str "bit_score",
            value real { 292610051387546, 10, -13 }
          },
          {
            id str "num_ident",
            value int 10
          },
          {
            id str "comp_adjustment_method",
            value int 2
          },
          {
            id str "num_positives",
            value int 15
          },
          {
            id str "hsp_percent_coverage",
            value real { 123279569892473, 10, -13 }
          }
        },
        segs std {
          {
            dim 2,
            ids {
              local str "Query_2",
              local str "SI2.2.0_13149"
            },
            loc {
              int {
                from 164,
                to 185,
                strand unknown,
                id local str "Query_2"
              },
              int {
                from 237,
                to 302,
                strand plus,
                id local str "SI2.2.0_13149"
              }
            }
          }
        }
      },
      {
        type partial,
        dim 2,
        score {
          {
            id str "score",
            value int 48
          },
          {
            id str "e_value",
            value real { 489490109366324, 10, -15 }
          },
          {
            id str "bit_score",
            value real { 23097811924077, 10, -12 }
          },
          {
            id str "num_ident",
            value int 13
          },
          {
            id str "comp_adjustment_method",
            value int 2
          },
          {
            id str "num_positives",
            value int 17
          },
          {
            id str "hsp_percent_coverage",
            value real { 160913978494624, 10, -13 }
          }
        },
        segs std {
          {
            dim 2,
            ids {
              local str "Query_2",
              local str "SI2.2.0_09379"
            },
            loc {
              int {
                from 58,
                to 72,
                strand unknown,
                id local str "Query_2"
              },
              int {
                from 103,
                to 147,
                strand minus,
                id local str "SI2.2.0_09379"
              }
            }
          },
          {
            dim 2,
            ids {
              local str "Query_2",
              local str "SI2.2.0_09379"
            },
            loc {
              int {
                from 73,
                to 73,
                strand unknown,
                id local str "Query_2"
              },
              empty local str "SI2.2.0_09379"
            }
          },
          {
            dim 2,
            ids {
              local str "Query_2",
              local str "SI2.2.0_09379"
            },
            loc {
              int {
                from 74,
                to 86,
                strand unknown,
                id local str "Query_2"
              },
              int {
                from 64,
                to 102,
                strand minus,
                id local str "SI2.2.0_09379"
              }
            }
          }
        }
      },
      {
        type partial,
        dim 2,
        score {
          {
            id str "score",
            value int 45
          },
          {
            id str "e_value",
            value real { 724328385986037, 10, -15 }
          },
          {
            id str "bit_score",
            value real { 219422131963249, 10, -13 }
          },
          {
            id str "num_ident",
            value int 7
          },
          {
            id str "comp_adjustment_method",
            value int 1
          },
          {
            id str "num_positives",
            value int 14
          },
          {
            id str "hsp_percent_coverage",
            value real { 117903225806452, 10, -13 }
          }
        },
        segs std {
          {
            dim 2,
            ids {
              local str "Query_2",
              local str "SI2.2.0_02019"
            },
            loc {
              int {
                from 119,
                to 139,
                strand unknown,
                id local str "Query_2"
              },
              int {
                from 46,
                to 108,
                strand minus,
                id local str "SI2.2.0_02019"
              }
            }
          }
        }
      },
      {
        type partial,
        dim 2,
        score {
          {
            id str "score",
            value int 48
          },
          {
            id str "e_value",
            value real { 137339689136456, 10, -14 }
          },
          {
            id str "bit_score",
            value real { 23097811924077, 10, -12 }
          },
          {
            id str "num_ident",
            value int 14
          },
          {
            id str "comp_adjustment_method",
            value int 2
          },
          {
            id str "num_positives",
            value int 25
          },
          {
            id str "hsp_percent_coverage",
            value real { 252311827956989, 10, -13 }
          }
        },
        segs std {
          {
            dim 2,
            ids {
              local str "Query_2",
              local str "SI2.2.0_03352"
            },
            loc {
              int {
                from 41,
                to 52,
                strand unknown,
                id local str "Query_2"
              },
              int {
                from 495,
                to 530,
                strand plus,
                id local str "SI2.2.0_03352"
              }
            }
          },
          {
            dim 2,
            ids {
              local str "Query_2",
              local str "SI2.2.0_03352"
            },
            loc {
              empty local str "Query_2",
              int {
                from 531,
                to 551,
                strand plus,
                id local str "SI2.2.0_03352"
              }
            }
          },
          {
            dim 2,
            ids {
              local str "Query_2",
              local str "SI2.2.0_03352"
            },
            loc {
              int {
                from 53,
                to 86,
                strand unknown,
                id local str "Query_2"
              },
              int {
                from 552,
                to 653,
                strand plus,
                id local str "SI2.2.0_03352"
              }
            }
          }
        }
      },
      {
        type partial,
        dim 2,
        score {
          {
            id str "score",
            value int 44
          },
          {
            id str "e_value",
            value real { 3025295033467, 10, -12 }
          },
          {
            id str "bit_score",
            value real { 215570136204075, 10, -13 }
          },
          {
            id str "num_ident",
            value int 22
          },
          {
            id str "comp_adjustment_method",
            value int 2
          },
          {
            id str "num_positives",
            value int 32
          },
          {
            id str "hsp_percent_coverage",
            value real { 354462365591398, 10, -13 }
          }
        },
        segs std {
          {
            dim 2,
            ids {
              local str "Query_2",
              local str "SI2.2.0_05451"
            },
            loc {
              int {
                from 97,
                to 115,
                strand unknown,
                id local str "Query_2"
              },
              int {
                from 26,
                to 82,
                strand plus,
                id local str "SI2.2.0_05451"
              }
            }
          },
          {
            dim 2,
            ids {
              local str "Query_2",
              local str "SI2.2.0_05451"
            },
            loc {
              empty local str "Query_2",
              int {
                from 83,
                to 130,
                strand plus,
                id local str "SI2.2.0_05451"
              }
            }
          },
          {
            dim 2,
            ids {
              local str "Query_2",
              local str "SI2.2.0_05451"
            },
            loc {
              int {
                from 116,
                to 125,
                strand unknown,
                id local str "Query_2"
              },
              int {
                from 131,
                to 160,
                strand plus,
                id local str "SI2.2.0_05451"
              }
            }
          },
          {
            dim 2,
            ids {
              local str "Query_2",
              local str "SI2.2.0_05451"
            },
            loc {
              int {
                from 126,
                to 138,
                strand unknown,
                id local str "Query_2"
              },
              empty local str "SI2.2.0_05451"
            }
          },
          {
            dim 2,
            ids {
              local str "Query_2",
              local str "SI2.2.0_05451"
            },
            loc {
              int {
                from 139,
                to 148,
                strand unknown,
                id local str "Query_2"
              },
              int {
                from 161,
                to 190,
                strand plus,
                id local str "SI2.2.0_05451"
              }
            }
          },
          {
            dim 2,
            ids {
              local str "Query_2",
              local str "SI2.2.0_05451"
            },
            loc {
              int {
                from 149,
                to 154,
                strand unknown,
                id local str "Query_2"
              },
              empty local str "SI2.2.0_05451"
            }
          },
          {
            dim 2,
            ids {
              local str "Query_2",
              local str "SI2.2.0_05451"
            },
            loc {
              int {
                from 155,
                to 161,
                strand unknown,
                id local str "Query_2"
              },
              int {
                from 191,
                to 211,
                strand plus,
                id local str "SI2.2.0_05451"
              }
            }
          }
        }
      },
      {
        type partial,
        dim 2,
        score {
          {
            id str "score",
            value int 41
          },
          {
            id str "e_value",
            value real { 665464998703274, 10, -14 }
          },
          {
            id str "bit_score",
            value real { 204014148926555, 10, -13 }
          },
          {
            id str "num_ident",
            value int 8
          },
          {
            id str "comp_adjustment_method",
            value int 2
          },
          {
            id str "num_positives",
            value int 14
          },
          {
            id str "hsp_percent_coverage",
            value real { 101774193548387, 10, -13 }
          }
        },
        segs std {
          {
            dim 2,
            ids {
              local str "Query_2",
              local str "SI2.2.0_05852"
            },
            loc {
              int {
                from 141,
                to 158,
                strand unknown,
                id local str "Query_2"
              },
              int {
                from 192,
                to 245,
                strand minus,
                id local str "SI2.2.0_05852"
              }
            }
          }
        }
      }
    },
    masks {
      {
        locations {
          packed-int {
            {
              from 5,
              to 20,
              id local str "Query_2"
            }
          }
        },
        frame notset
      }
    },
    ka-blocks {
      {
        lambda { 322429245874507, 10, -15 },
        k { 139801292049695, 10, -15 },
        h { 436862255107731, 10, -15 },
        gapped FALSE
      },
      {
        lambda { 267, 10, -3 },
        k { 41, 10, -3 },
        h { 14, 10, -2 },
        gapped TRUE
      }
    },
    search-stats {
      "Effective search space: 9254832",
      "Effective search space used: 9254832",
      "Length adjustment: 61"
    }
  }
}