Sha256: 85878b54e4cf69946bfcb30dcecd18ca08c55ff63806dbed789289b8d6c977d4
Contents?: true
Size: 1.61 KB
Versions: 7
Compression:
Stored size: 1.61 KB
Contents
= {Ms-InSilico}[http://mspire.rubyforge.org/projects/ms-in_silico] An {Mspire}[http://mspire.rubyforge.org] library supporting in-silico calculations for mass spec data. == Description Ms-InSilico provides the following modules: * Ms::InSilico::Digester (protein digestion) * Ms::InSilico::Spectrum (peptide fragmentation) Corresponding Tap[http://tap.rubyforge.org] tasks are also provided. * Lighthouse[http://bahuvrihi.lighthouseapp.com/projects/16692-mspire/tickets] * Github[http://github.com/bahuvrihi/ms-in_silico/tree/master] * {Google Group}[http://groups.google.com/group/mspire-forum] == Usage require 'ms/in_silico/digester' require 'ms/in_silico/spectrum' include Ms::InSilico trypsin = Digester['Trypsin'] peptides = trypsin.digest('MIVIGRSIVHPYITNEYEPFAAEKQQILSIMAG') # => [ # 'MIVIGR', # 'SIVHPYITNEYEPFAAEK', # 'QQILSIMAG'] spectrum = Spectrum.new(peptides[0]) spectrum.parent_ion_mass # => 688.417442373391 spectrum.series('b') # => [ # 132.047761058391, # 245.131825038791, # 344.200238954991, # 457.284302935391, # 514.305766658991, # 670.406877687091] == Installation Ms-InSilico is available as a gem on RubyForge[http://rubyforge.org/projects/mspire]. Use: % gem install ms-in_silico == Info Copyright (c) 2008-2009, Regents of the University of Colorado. Developer:: {Simon Chiang}[http://bahuvrihi.wordpress.com], {Biomolecular Structure Program}[http://biomol.uchsc.edu/], {Hansen Lab}[http://hsc-proteomics.uchsc.edu/hansenlab/] Support:: CU Denver School of Medicine Deans Academic Enrichment Fund Licence:: {MIT-Style}[link:files/MIT-LICENSE.html]
Version data entries
7 entries across 7 versions & 1 rubygems