# # = bio/appl/blast.rb - BLAST wrapper # # Copyright:: Copyright (C) 2001,2008 Mitsuteru C. Nakao # Copyright:: Copyright (C) 2002,2003 Toshiaki Katayama # Copyright:: Copyright (C) 2006 Jan Aerts # Copyright:: Copyright (C) 2008 Naohisa Goto # License:: The Ruby License # # require 'bio/command' require 'shellwords' require 'stringio' require 'bio/io/flatfile' module Bio # == Description # # The Bio::Blast class contains methods for running local or remote BLAST # searches, as well as for parsing of the output of such BLASTs (i.e. the # BLAST reports). For more information on similarity searches and the BLAST # program, see http://www.ncbi.nlm.nih.gov/Education/BLASTinfo/similarity.html. # # == Usage # # require 'bio' # # # To run an actual BLAST analysis: # # 1. create a BLAST factory # remote_blast_factory = Bio::Blast.remote('blastp', 'swissprot', # '-e 0.0001', 'genomenet') # #or: # local_blast_factory = Bio::Blast.local('blastn','/path/to/db') # # # 2. run the actual BLAST by querying the factory # report = remote_blast_factory.query(sequence_text) # # # Then, to parse the report, see Bio::Blast::Report # # == See also # # * Bio::Blast::Report # * Bio::Blast::Report::Hit # * Bio::Blast::Report::Hsp # # == References # # * http://www.ncbi.nlm.nih.gov/blast/ # * http://www.ncbi.nlm.nih.gov/Education/BLASTinfo/similarity.html # * http://blast.genome.jp/ideas/ideas.html#blast # class Blast autoload :Fastacmd, 'bio/io/fastacmd' autoload :Report, 'bio/appl/blast/report' autoload :Report_tab, 'bio/appl/blast/report' autoload :Default, 'bio/appl/blast/format0' autoload :WU, 'bio/appl/blast/wublast' autoload :Bl2seq, 'bio/appl/bl2seq/report' autoload :RPSBlast, 'bio/appl/blast/rpsblast' autoload :NCBIOptions, 'bio/appl/blast/ncbioptions' autoload :Remote, 'bio/appl/blast/remote' # This is a shortcut for Bio::Blast.new: # Bio::Blast.local(program, database, options) # is equivalent to # Bio::Blast.new(program, database, options, 'local') # --- # *Arguments*: # * _program_ (required): 'blastn', 'blastp', 'blastx', 'tblastn' or 'tblastx' # * _db_ (required): name of the local database # * _options_: blastall options \ # (see http://www.genome.jp/dbget-bin/show_man?blast2) # * _blastall_: full path to blastall program (e.g. "/opt/bin/blastall"; DEFAULT: "blastall") # *Returns*:: Bio::Blast factory object def self.local(program, db, options = '', blastall = nil) f = self.new(program, db, options, 'local') if blastall then f.blastall = blastall end f end # Bio::Blast.remote does exactly the same as Bio::Blast.new, but sets # the remote server 'genomenet' as its default. # --- # *Arguments*: # * _program_ (required): 'blastn', 'blastp', 'blastx', 'tblastn' or 'tblastx' # * _db_ (required): name of the remote database # * _options_: blastall options \ # (see http://www.genome.jp/dbget-bin/show_man?blast2) # * _server_: server to use (DEFAULT = 'genomenet') # *Returns*:: Bio::Blast factory object def self.remote(program, db, option = '', server = 'genomenet') self.new(program, db, option, server) end # Bio::Blast.report parses given data, # and returns an array of report # (Bio::Blast::Report or Bio::Blast::Default::Report) objects, # or yields each report object when a block is given. # # Supported formats: NCBI default (-m 0), XML (-m 7), tabular (-m 8). # # --- # *Arguments*: # * _input_ (required): input data # * _parser_: type of parser. see Bio::Blast::Report.new # *Returns*:: Undefiend when a block is given. Otherwise, an Array containing report (Bio::Blast::Report or Bio::Blast::Default::Report) objects. def self.reports(input, parser = nil) begin istr = input.to_str rescue NoMethodError istr = nil end if istr then input = StringIO.new(istr) end raise 'unsupported input data type' unless input.respond_to?(:gets) # if proper parser is given, emulates old behavior. case parser when :xmlparser, :rexml ff = Bio::FlatFile.new(Bio::Blast::Report, input) if block_given? then ff.each do |e| yield e end return [] else return ff.to_a end when :tab istr = input.read unless istr rep = Report.new(istr, parser) if block_given? then yield rep return [] else return [ rep ] end end # preparation of the new format autodetection rule if needed if !defined?(@@reports_format_autodetection_rule) or !@@reports_format_autodetection_rule then regrule = Bio::FlatFile::AutoDetect::RuleRegexp blastxml = regrule[ 'Bio::Blast::Report', /\<\!DOCTYPE BlastOutput PUBLIC / ] blast = regrule[ 'Bio::Blast::Default::Report', /^BLAST.? +[\-\.\w]+ +\[[\-\.\w ]+\]/ ] tblast = regrule[ 'Bio::Blast::Default::Report_TBlast', /^TBLAST.? +[\-\.\w]+ +\[[\-\.\w ]+\]/ ] tab = regrule[ 'Bio::Blast::Report_tab', /^([^\t]*\t){11}[^\t]*$/ ] auto = Bio::FlatFile::AutoDetect[ blastxml, blast, tblast, tab ] # sets priorities blastxml.is_prior_to blast blast.is_prior_to tblast tblast.is_prior_to tab # rehash auto.rehash @@report_format_autodetection_rule = auto end # Creates a FlatFile object with dummy class ff = Bio::FlatFile.new(Object, input) ff.dbclass = nil # file format autodetection 3.times do break if ff.eof? or ff.autodetect(31, @@report_format_autodetection_rule) end # If format detection failed, assumed to be tabular (-m 8) ff.dbclass = Bio::Blast::Report_tab unless ff.dbclass if block_given? then ff.each do |entry| yield entry end ret = [] else ret = ff.to_a end ret end #-- # the method Bio::Blast.reports is moved from bio/appl/blast/report.rb. #++ # Note that this is the old implementation of Bio::Blast.reports. # The aim of this method is keeping compatibility for older BLAST # XML documents which might not be parsed by the new # Bio::Blast.reports nor Bio::FlatFile. # (Though we are not sure whether such documents exist or not.) # # Bio::Blast.reports_xml parses given data, # and returns an array of Bio::Blast::Report objects, or # yields each Bio::Blast::Report object when a block is given. # # It can be used only for XML format. # For default (-m 0) format, consider using Bio::FlatFile, or # Bio::Blast.reports. # # --- # *Arguments*: # * _input_ (required): input data # * _parser_: type of parser. see Bio::Blast::Report.new # *Returns*:: Undefiend when a block is given. Otherwise, an Array containing Bio::Blast::Report objects. def self.reports_xml(input, parser = nil) ary = [] input.each_line("\n") do |xml| xml.sub!(/[^<]*( tag next if xml.empty? # skip trailing no hits rep = Report.new(xml, parser) if rep.reports then if block_given? rep.reports.each { |r| yield r } else ary.concat rep.reports end else if block_given? yield rep else ary.push rep end end end return ary end # Program name (_-p_ option for blastall): blastp, blastn, blastx, tblastn # or tblastx attr_accessor :program # Database name (_-d_ option for blastall) attr_accessor :db # Options for blastall attr_reader :options # Sets options for blastall def options=(ary) @options = set_options(ary) end # Server to submit the BLASTs to attr_reader :server # Sets server to submit the BLASTs to. # The exec_xxxx method should be defined in Bio::Blast or # Bio::Blast::Remote::Xxxx class. def server=(str) @server = str begin m = Bio::Blast::Remote.const_get(@server.capitalize) rescue NameError m = nil end if m and !(self.is_a?(m)) then # lazy include Bio::Blast::Remote::XXX module self.class.class_eval { include m } end return @server end # Full path for blastall. (default: 'blastall'). attr_accessor :blastall # Substitution matrix for blastall -M attr_accessor :matrix # Filter option for blastall -F (T or F). attr_accessor :filter # Returns a String containing blast execution output in as is the Bio::Blast#format. attr_reader :output # Output report format for blastall -m # # 0, pairwise; 1; 2; 3; 4; 5; 6; 7, XML Blast outpu;, 8, tabular; # 9, tabular with comment lines; 10, ASN text; 11, ASN binery [intege]. attr_accessor :format # attr_writer :parser # to change :xmlparser, :rexml, :tab # Creates a Bio::Blast factory object. # # To run any BLAST searches, a factory has to be created that describes a # certain BLAST pipeline: the program to use, the database to search, any # options and the server to use. E.g. # # blast_factory = Bio::Blast.new('blastn','dbsts', '-e 0.0001 -r 4', 'genomenet') # # --- # *Arguments*: # * _program_ (required): 'blastn', 'blastp', 'blastx', 'tblastn' or 'tblastx' # * _db_ (required): name of the (local or remote) database # * _options_: blastall options \ # (see http://www.genome.jp/dbget-bin/show_man?blast2) # * _server_: server to use (e.g. 'genomenet'; DEFAULT = 'local') # *Returns*:: Bio::Blast factory object def initialize(program, db, opt = [], server = 'local') @program = program @db = db @blastall = 'blastall' @matrix = nil @filter = nil @output = '' @parser = nil @format = nil @options = set_options(opt, program, db) self.server = server end # This method submits a sequence to a BLAST factory, which performs the # actual BLAST. # # # example 1 # seq = Bio::Sequence::NA.new('agggcattgccccggaagatcaagtcgtgctcctg') # report = blast_factory.query(seq) # # # example 2 # str <lcl|MySequence # MPPSAISKISNSTTPQVQSSSAPNLTMLEGKGISVEKSFRVYSEEENQNQHKAKDSLGF # KELEKDAIKNSKQDKKDHKNWLETLYDQAEQKWLQEPKKKLQDLIKNSGDNSRVILKDS # END_OF_FASTA # report = blast_factory.query(str) # # Bug note: When multi-FASTA is given and the format is 7 (XML) or 8 (tab), # it should return an array of Bio::Blast::Report objects, # but it returns a single Bio::Blast::Report object. # This is a known bug and should be fixed in the future. # # --- # *Arguments*: # * _query_ (required): single- or multiple-FASTA formatted sequence(s) # *Returns*:: a Bio::Blast::Report (or Bio::Blast::Default::Report) object when single query is given. When multiple sequences are given as the query, it returns an array of Bio::Blast::Report (or Bio::Blast::Default::Report) objects. If it can not parse result, nil will be returnd. def query(query) case query when Bio::Sequence query = query.output(:fasta) when Bio::Sequence::NA, Bio::Sequence::AA, Bio::Sequence::Generic query = query.to_fasta('query', 70) else query = query.to_s end @output = self.__send__("exec_#{@server}", query) report = parse_result(@output) return report end # Returns options of blastall def option # backward compatibility Bio::Command.make_command_line(options) end # Set options for blastall def option=(str) # backward compatibility self.options = Shellwords.shellwords(str) end private def set_options(opt = nil, program = nil, db = nil) opt = @options unless opt # when opt is a String, splits to an array begin a = opt.to_ary rescue NameError #NoMethodError # backward compatibility a = Shellwords.shellwords(opt) end ncbiopt = NCBIOptions.new(a) if fmt = ncbiopt.get('-m') then @format = fmt.to_i else _ = Bio::Blast::Report #dummy to load XMLParser or REXML if defined?(XMLParser) or defined?(REXML) @format ||= 7 else @format ||= 8 end end mtrx = ncbiopt.get('-M') @matrix = mtrx if mtrx fltr = ncbiopt.get('-F') @filter = fltr if fltr # special treatment for '-p' if program then @program = program ncbiopt.delete('-p') else program = ncbiopt.get('-p') @program = program if program end # special treatment for '-d' if db then @db = db ncbiopt.delete('-d') else db = ncbiopt.get('-d') @db = db if db end # returns an array of string containing options return ncbiopt.options end # parses result def parse_result(str) if @format.to_i == 0 then ary = Bio::FlatFile.open(Bio::Blast::Default::Report, StringIO.new(str)) { |ff| ff.to_a } case ary.size when 0 return nil when 1 return ary[0] else return ary end else Report.new(str, @parser) end end # returns an array containing NCBI BLAST options def make_command_line_options set_options cmd = [] if @program cmd.concat([ '-p', @program ]) end if @db cmd.concat([ '-d', @db ]) end if @format cmd.concat([ '-m', @format.to_s ]) end if @matrix cmd.concat([ '-M', @matrix ]) end if @filter cmd.concat([ '-F', @filter ]) end ncbiopts = NCBIOptions.new(@options) ncbiopts.make_command_line_options(cmd) end # makes command line. def make_command_line cmd = make_command_line_options cmd.unshift @blastall cmd end # Local execution of blastall def exec_local(query) cmd = make_command_line @output = Bio::Command.query_command(cmd, query) return @output end # This method is obsolete. # # Runs genomenet with '-m 8' option. # Note that the format option is overwritten. def exec_genomenet_tab(query) warn "Bio::Blast#server=\"genomenet_tab\" is deprecated." @format = 8 exec_genomenet(query) end end # class Blast end # module Bio