# # test/unit/bio/appl/blast/test_rpsblast.rb - Unit test for Bio::Blast::RPSBlast::Report # # Copyright:: Copyright (C) 2008 # Naohisa Goto # License:: The Ruby License # # $Id:$ # # loading helper routine for testing bioruby require 'pathname' load Pathname.new(File.join(File.dirname(__FILE__), ['..'] * 4, 'bioruby_test_helper.rb')).cleanpath.to_s # libraries needed for the tests require 'test/unit' require 'digest/sha1' require 'bio/io/flatfile' require 'bio/appl/blast/rpsblast' module Bio module TestRPSBlast TestFileName = Pathname.new(File.join(BioRubyTestDataPath, 'rpsblast', 'misc.rpsblast')).cleanpath.to_s class TestRPSBlastSplitter < Test::Unit::TestCase def setup @io = File.open(TestFileName) @io.binmode @bstream = Bio::FlatFile::BufferedInputStream.new(@io, TestFileName) @klass = Bio::Blast::RPSBlast::Report @splitter = Bio::Blast::RPSBlast::RPSBlastSplitter.new(@klass, @bstream) end def teardown @io.close end def test_skip_leader assert_equal(nil, @splitter.skip_leader) assert_equal(0, @bstream.pos) # force to push back white spaces @bstream.ungets(" \n\n \t\t \n") assert_equal(nil, @splitter.skip_leader) assert_equal("RPS-BLAST 2.2.18 [Mar-02-2008]\n", @bstream.gets) end def test_rewind assert_nothing_raised { @splitter.rewind } end def test_get_entry assert(raw = @splitter.get_entry) assert_equal(4388, raw.size) assert_equal('12201ff286b16f8578e2a3b0778c721438ac8278', Digest::SHA1.hexdigest(raw)) assert(raw = @splitter.get_entry) assert_equal(245, raw.size) assert_equal('f5fb1ac1aa62ba65a68c5c7c8240c0a9fc047a46', Digest::SHA1.hexdigest(raw)) assert(raw = @splitter.get_entry) assert_equal(3144, raw.size) assert_equal('db0ff4bf9901186758b2a0d6e94734a53733631f', Digest::SHA1.hexdigest(raw)) assert_nil(@splitter.get_entry) end def test_entry_pos @splitter.entry_pos_flag = true @splitter.get_entry assert_equal(0, @splitter.entry_start_pos) assert_equal(4388, @splitter.entry_ended_pos) @splitter.get_entry assert_equal(4388, @splitter.entry_start_pos) assert_equal(4461, @splitter.entry_ended_pos) @splitter.get_entry assert_equal(4461, @splitter.entry_start_pos) assert_equal(7433, @splitter.entry_ended_pos) end end #class TestRPSBlastSplitter class TestRPSBlastReport < Test::Unit::TestCase def setup @flatfile = Bio::FlatFile.open(Bio::Blast::RPSBlast::Report, TestFileName) @obj = @flatfile.next_entry end def teardown @flatfile.close end def test_program assert_equal('RPS-BLAST', @obj.program) end def test_version exp = 'RPS-BLAST 2.2.18 [Mar-02-2008]' assert_equal(exp, @obj.version) end def test_version_number assert_equal('2.2.18', @obj.version_number) end def test_version_date assert_equal('Mar-02-2008', @obj.version_date) end def test_db assert_equal('Pfam.v.22.0', @obj.db) end def test_query_def ary = [ 'TestSequence mixture of globin and rhodopsin (computationally randomly concatenated)', 'randomseq3', 'gi|6013469|gb|AAD49229.2|AF159462_1 EHEC factor for adherence [Escherichia coli]' ] @flatfile.rewind @flatfile.each do |rep| assert_equal(ary.shift, rep.query_def) end assert(ary.empty?) end def test_query_len ary = [ 495, 1087, 3223 ] @flatfile.rewind @flatfile.each do |rep| assert_equal(ary.shift, rep.query_len) end assert(ary.empty?) end def test_hits_size ary = [ 3, 0, 2 ] @flatfile.rewind @flatfile.each do |rep| assert_equal(ary.shift, rep.hits.size) end assert(ary.empty?) end def test_iterations_size ary = [ 1, 1, 1 ] @flatfile.rewind @flatfile.each do |rep| assert_equal(ary.shift, rep.iterations.size) end assert(ary.empty?) end end #class TestRPSBlastReport class TestRPSBlastReportHit < Test::Unit::TestCase def setup flatfile = Bio::FlatFile.open(Bio::Blast::RPSBlast::Report, TestFileName) @hits = flatfile.next_entry.hits flatfile.close end def test_hsps_size ary = [ 1, 2, 1 ] @hits.each do |h| assert_equal(ary.shift, h.hsps.size) end assert(ary.empty?) end def test_len assert_equal(110, @hits[0].len) assert_equal(258, @hits[1].len) assert_equal(336, @hits[2].len) end def test_target_len assert_equal(110, @hits[0].target_len) assert_equal(258, @hits[1].target_len) assert_equal(336, @hits[2].target_len) end def test_target_def assert_equal('gnl|CDD|84466 pfam00042, Globin, Globin..', @hits[0].target_def) assert_equal("gnl|CDD|84429 pfam00001, 7tm_1, 7 transmembrane receptor (rhodopsin family). This" \ " family contains, amongst other G-protein-coupled" \ " receptors (GCPRs), members of the opsin family, which" \ " have been considered to be typical members of the" \ " rhodopsin superfamily. They share several motifs, mainly" \ " the seven transmembrane helices, GCPRs of the rhodopsin" \ " superfamily. All opsins bind a chromophore, such as" \ " 11-cis-retinal. The function of most opsins other than" \ " the photoisomerases is split into two steps: light" \ " absorption and G-protein activation. Photoisomerases, on" \ " the other hand, are not coupled to G-proteins - they are" \ " thought to generate and supply the chromophore that is" \ " used by visual opsins..", @hits[1].target_def) assert_equal("gnl|CDD|87195 pfam06976, DUF1300, Protein of unknown function (DUF1300). This" \ " family represents a conserved region approximately 80" \ " residues long within a number of proteins of unknown" \ " function that seem to be specific to C. elegans. Some" \ " family members contain more than one copy of this" \ " region..", @hits[2].target_def) end def test_definition assert_equal('gnl|CDD|84466 pfam00042, Globin, Globin..', @hits[0].definition) assert_equal("gnl|CDD|84429 pfam00001, 7tm_1, 7 transmembrane receptor (rhodopsin family). This" \ " family contains, amongst other G-protein-coupled" \ " receptors (GCPRs), members of the opsin family, which" \ " have been considered to be typical members of the" \ " rhodopsin superfamily. They share several motifs, mainly" \ " the seven transmembrane helices, GCPRs of the rhodopsin" \ " superfamily. All opsins bind a chromophore, such as" \ " 11-cis-retinal. The function of most opsins other than" \ " the photoisomerases is split into two steps: light" \ " absorption and G-protein activation. Photoisomerases, on" \ " the other hand, are not coupled to G-proteins - they are" \ " thought to generate and supply the chromophore that is" \ " used by visual opsins..", @hits[1].definition) assert_equal("gnl|CDD|87195 pfam06976, DUF1300, Protein of unknown function (DUF1300). This" \ " family represents a conserved region approximately 80" \ " residues long within a number of proteins of unknown" \ " function that seem to be specific to C. elegans. Some" \ " family members contain more than one copy of this" \ " region..", @hits[2].definition) end def test_evalue assert_equal(2.0e-25, @hits[0].evalue) assert_equal(2.0e-19, @hits[1].evalue) assert_equal(0.003, @hits[2].evalue) end def test_bit_score assert_equal(110.0, @hits[0].bit_score) assert_equal(90.8, @hits[1].bit_score) assert_equal(37.1, @hits[2].bit_score) end def test_identity assert_equal(50, @hits[0].identity) assert_equal(37, @hits[1].identity) assert_equal(32, @hits[2].identity) end def test_overlap assert_equal(110, @hits[0].overlap) assert_equal(162, @hits[1].overlap) assert_equal(145, @hits[2].overlap) end def test_query_seq assert_equal("EKQLITGLWGKV--NVAECGAEALARLLIVYPWTQRFFASFGNLSSPTAILGNPMVRAHGKKVLTSFGDAVKNLDN---IKNTFSQLSELHCDKLHVDPENFRLLGDILI", @hits[0].query_seq) assert_equal("HAIMGVAFTWVMALACAAPPLAGWSRY-IPEGLQCSCGIDYYTLKPEVNNESFVIYMFVVHFTIPMIIIFFCYGQLVFTV----KEAAAQQQESATTQKAEKEVTRMVIIMVIAFLICWVPYASVAFY--IFTHQGSNFGPIFMTIPAFFAKSAAIYNPVIY", @hits[1].query_seq) assert_equal("IDYYTLKPEVNNESFVIYMFV--VHFT-IPMIIIFFCYGQLVFTVKEAAAQQQESATTQKAEKEVTRMVIIMVIAFLICWVPYASVAFYIFTHQGSNFGPIFMTIPAFFAKSAAIYNPVIYIM----MNKQFRNCMLTTICCGKN", @hits[2].query_seq) end def test_target_seq assert_equal("QKALVKASWGKVKGNAPEIGAEILARLFTAYPDTKAYFPKFGDLSTAEALKSSPKFKAHGKKVLAALGEAVKHLDDDGNLKAALKKLGARHAKRGHVDPANFKLFGEALL", @hits[0].target_seq) assert_equal("RAKVLILLVWVLALLLSLPPLLFSWLRTVEEGNVTTCLIDFPEESLLR---SYTLLSTLLGFVLPLLVILVCYTRILRTLRRRARSGASIARSLKRRSSSERKAAKMLLVVVVVFVLCWLPYHIVLLLDSLCLLSIIRVLPTALLITLWLAYVNSCLNPIIY", @hits[1].target_seq) assert_equal("IEYIIETTELFGSSYEILLLIEGILFKLIPSIILPIATILLIFQLKKNKKVSSRSSTSSSSNDRSTKLVTFVTISFLIATVPLGILYLIKFFVFEYEGLVMIIDKLAIIFTFLSTINGTIHFLICYFMSSQYRNTVREMFGRKKK", @hits[2].target_seq) end def test_midline assert_equal("+K L+ WGKV N E GAE LARL YP T+ +F FG+LS+ A+ +P +AHGKKVL + G+AVK+LD+ +K +L H + HVDP NF+L G+ L+", @hits[0].midline) assert_equal(" A + + WV+AL + PPL + EG +C ID+ S+ + ++ F +P+++I CY +++ T+ + A+ + +E++ +M++++V+ F++CW+PY V + P + I + A + NP+IY", @hits[1].midline) assert_equal("I+Y E+ S+ I + + + F IP II+ L+F +K+ S+T+ + T++V + I+FLI VP + F + + A + N I+ + M+ Q+RN + K ", @hits[2].midline) end def test_query_start assert_equal(148, @hits[0].query_start) assert_equal(299, @hits[1].query_start) assert_equal(336, @hits[2].query_start) end def test_query_end assert_equal(252, @hits[0].query_end) assert_equal(453, @hits[1].query_end) assert_equal(473, @hits[2].query_end) end def test_target_start assert_equal(1, @hits[0].target_start) assert_equal(100, @hits[1].target_start) assert_equal(192, @hits[2].target_start) end def test_target_end assert_equal(110, @hits[0].target_end) assert_equal(258, @hits[1].target_end) assert_equal(336, @hits[2].target_end) end def test_lap_at assert_equal([148, 252, 1, 110], @hits[0].lap_at) assert_equal([299, 453, 100, 258], @hits[1].lap_at) assert_equal([336, 473, 192, 336], @hits[2].lap_at) end end #class TestRPSBlastHit class TestRPSBlastHSP < Test::Unit::TestCase def setup flatfile = Bio::FlatFile.open(Bio::Blast::RPSBlast::Report, TestFileName) @hsps = flatfile.next_entry.hits[1].hsps flatfile.close end def test_bit_score assert_equal(90.8, @hsps[0].bit_score) assert_equal(73.4, @hsps[1].bit_score) end def test_score assert_equal(225, @hsps[0].score) assert_equal(180, @hsps[1].score) end def test_evalue assert_equal(2.0e-19, @hsps[0].evalue) assert_equal(3.0e-14, @hsps[1].evalue) end def test_identity assert_equal(37, @hsps[0].identity) assert_equal(32, @hsps[1].identity) end def test_gaps assert_equal(10, @hsps[0].gaps) assert_equal(nil, @hsps[1].gaps) end def test_positive assert_equal(76, @hsps[0].positive) assert_equal(47, @hsps[1].positive) end def test_align_len assert_equal(162, @hsps[0].align_len) assert_equal(86, @hsps[1].align_len) end def test_query_from assert_equal(299, @hsps[0].query_from) assert_equal(55, @hsps[1].query_from) end def test_query_to assert_equal(453, @hsps[0].query_to) assert_equal(140, @hsps[1].query_to) end def test_hit_from assert_equal(100, @hsps[0].hit_from) assert_equal(2, @hsps[1].hit_from) end def test_hit_to assert_equal(258, @hsps[0].hit_to) assert_equal(87, @hsps[1].hit_to) end def test_qseq assert_equal("HAIMGVAFTWVMALACAAPPLAGWSRY-IPEGLQCSCGIDYYTLKPEVNNESFVIYMFVVHFTIPMIIIFFCYGQLVFTV----KEAAAQQQESATTQKAEKEVTRMVIIMVIAFLICWVPYASVAFY--IFTHQGSNFGPIFMTIPAFFAKSAAIYNPVIY", @hsps[0].qseq) assert_equal("NFLTLYVTVQHKKLRTPLNYILLNLAVADLFMVLGGFTSTLYTSLHGYFVFGPTGCNLEGFFATLGGEIALWSLVVLAIERYVVVC", @hsps[1].qseq) end def test_hseq assert_equal("RAKVLILLVWVLALLLSLPPLLFSWLRTVEEGNVTTCLIDFPEESLLR---SYTLLSTLLGFVLPLLVILVCYTRILRTLRRRARSGASIARSLKRRSSSERKAAKMLLVVVVVFVLCWLPYHIVLLLDSLCLLSIIRVLPTALLITLWLAYVNSCLNPIIY", @hsps[0].hseq) assert_equal("NLLVILVILRTKRLRTPTNIFLLNLAVADLLFLLTLPPWALYYLVGGDWPFGDALCKLVGALFVVNGYASILLLTAISIDRYLAIV", @hsps[1].hseq) end def test_midline assert_equal(" A + + WV+AL + PPL + EG +C ID+ S+ + ++ F +P+++I CY +++ T+ + A+ + +E++ +M++++V+ F++CW+PY V + P + I + A + NP+IY", @hsps[0].midline) assert_equal("N L + V ++ K+LRTP N LLNLAVADL +L LY + G + FG C L G + G ++ L ++I+RY+ + ", @hsps[1].midline) end def test_percent_identity assert_equal(22, @hsps[0].percent_identity) assert_equal(37, @hsps[1].percent_identity) end end #class TestRPSBlastHSP end #module TestRPSBlast end #module Bio